Pay in 4 interest-free payments of $81.94 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
Specificity: Claudin 1 Antibody detects endogenous levels of total Claudin 1
CLEC6A Antibody
Immunogen: A synthesized peptide derived from human MEIS1
AA Sequence: VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK
Phospho-Fyn (Tyr213+Tyr214) Antibody
Spike mutant protein: V362A, recombinant (hFc Tag) - NCP0117 For Neuronal Cells Specificity: Claudin 1 Antibody detectsSpike mutant protein: V362A, recombinant (hFc Tag) Catalogue Number: NCP0117 Product: PBS, pH7. 4 Swiss Prot: P0DTC2 Host: SARS CoV 2 Reactivity: 293F Applications: WB All Applications: The protein has a calculated MW of 50 kDa. Purification and Purity: The protein was purified from 293F and the purity is > 95% (by SDS PAGE). Storage and Stability: Store at 4C short term. Aliquot and store at 20C long term. Avoid freeze thaw cycles. Specificity: AA